PDB entry 1ulw

View 1ulw on RCSB PDB site
Description: Crystal structure of P450nor Ser73Gly/Ser75Gly mutant
Class: oxidoreductase
Keywords: Nitric oxide reductase, Cytochrome P450nor, OXIDOREDUCTASE
Deposited on 2003-09-16, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 55a1
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23295 (Start-401)
      • engineered (71)
      • engineered (73)
    Domains in SCOPe 2.07: d1ulwa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ulwA (A:)
    asgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekls
    kvrtrqgfpelgaggkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtv
    ddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngssta
    reasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagn
    atmvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmig
    dklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakae
    lttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulwA (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelgaggkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif