PDB entry 1ulu

View 1ulu on RCSB PDB site
Description: Crystal structure of tt0143 from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulua_
  • Chain 'B':
    Compound: enoyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulub_
  • Chain 'C':
    Compound: enoyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uluc_
  • Chain 'D':
    Compound: enoyl-acyl carrier protein reductase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uluA (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uluA (A:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvftkmydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvda
    gyhimg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uluB (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uluB (B:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uluC (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uluC (C:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhi
    mgme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uluD (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
    itgevvyvdagyhimgmeleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uluD (D:)
    mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
    llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
    sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
    kgvrvnaisagpvrkmydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdag
    yhimgmel