PDB entry 1ult

View 1ult on RCSB PDB site
Description: Crystal structure of tt0168 from Thermus thermophilus HB8
Deposited on 2003-09-16, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ulta_
  • Chain 'B':
    Domains in SCOP 1.69: d1ultb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ultA (A:)
    megermnafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrl
    mgglralgvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaed
    kvllfdpnllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacg
    mayttgttglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaa
    tlvgakqvlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvv
    ggsaaprsliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglp
    iplvrlrvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdia
    vwdeegyveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplav
    vvprgekptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ultA (A:)
    afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
    gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
    nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
    tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
    vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
    sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
    vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
    veikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplavvvprgek
    ptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ultB (B:)
    megermnafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrl
    mgglralgvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaed
    kvllfdpnllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacg
    mayttgttglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaa
    tlvgakqvlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvv
    ggsaaprsliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglp
    iplvrlrvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdia
    vwdeegyveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplav
    vvprgekptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ultB (B:)
    nafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglra
    lgvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfd
    pnllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttg
    ttglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgak
    qvlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaap
    rsliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrl
    rvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeeg
    yveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphrplavvvekptpeeln
    ehllkagdayvfaeeiprtflkralreqyknyyg