PDB entry 1ulr

View 1ulr on RCSB PDB site
Description: Crystal structure of tt0497 from Thermus thermophilus HB8
Class: hydrolase
Keywords: HYDROLASE, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.19
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acylphosphatase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ulra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ulrA (A:)
mprlvalvkgrvqgvgyrafaqkkalelglsgyaenlpdgrvevvaegpkealelflhhl
kqgprlarveavevqwgeeaglkgfhvy

    Sequence, based on observed residues (ATOM records): (download) 
    >1ulrA (A:)
prlvalvkgrvqgvgyrafaqkkalelglsgyaenlpdgrvevvaegpkealelflhhlk
qgprlarveavevqwgeeaglkgfhvy