PDB entry 1ulp

View 1ulp on RCSB PDB site
Description: n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, 25 structures
Class: cellulose degradation
Keywords: cellulose degradation, cellulose-binding domain, hydrolase
Deposited on 1996-07-27, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase c
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14090 (0-151)
      • conflict (138)
    Domains in SCOPe 2.07: d1ulpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulpA (A:)
    aspigegtfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegtty
    tlrytatastdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaadd
    pegqiafqlggfsadawtlclddvaldsevel