PDB entry 1ulo

View 1ulo on RCSB PDB site
Description: n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, minimized average structure
Class: cellulose degradation
Keywords: cellulose degradation, cellulose-binding domain, hydrolase
Deposited on 1996-07-27, released 1997-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endoglucanase c
  Species: Cellulomonas fimi
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14090 (0-151)
    • conflict (138)
  Domains in SCOP 1.75: d1uloa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uloA (A:)
  aspigegtfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegtty
  tlrytatastdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaadd
  pegqiafqlggfsadawtlclddvaldsevel