PDB entry 1ulm

View 1ulm on RCSB PDB site
Description: Crystal Structure of Pokeweed Lectin-D2 complexed with tri-N-acetylchitotriose
Class: sugar binding protein
Keywords: Lectin, chitin-binding, Hevein domain, SUGAR BINDING PROTEIN
Deposited on 2003-09-12, released 2003-12-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lectin-D2
  Species: Phytolacca americana [TaxId:3527]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83790
  Domains in SCOPe 2.01: d1ulma1, d1ulma2
• Chain 'B':
  Compound: lectin-D2
  Species: Phytolacca americana [TaxId:3527]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83790 (0-81)
  Domains in SCOPe 2.01: d1ulmb1, d1ulmb2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ulmA (A:)
  apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
  skygwcgysddhcedgcqsqcd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ulmB (B:)
  apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
  skygwcgysddhcedgcqsqcd