PDB entry 1ulm

View 1ulm on RCSB PDB site
Description: crystal structure of pokeweed lectin-d2 complexed with tri-n- acetylchitotriose
Deposited on 2003-09-12, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulmA (A:)
    apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
    skygwcgysddhcedgcqsqcd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulmB (B:)
    apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdywrcgrdfggrlceedmcc
    skygwcgysddhcedgcqsqcd