PDB entry 1ulk

View 1ulk on RCSB PDB site
Description: Crystal Structure of Pokeweed Lectin-C
Class: sugar binding protein
Keywords: lectin, chitin-binding protein, Hevein domain, PL-C, SUGAR BINDING PROTEIN
Deposited on 2003-09-12, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin-C
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulka1, d1ulka2, d1ulka3
  • Chain 'B':
    Compound: lectin-C
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulkb1, d1ulkb2, d1ulkb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulkA (A:)
    apvcgvrasgrvcpdgyccsqwgycgtteeycgkgcqsqcdynrcgkefggkechdelcc
    sqygwcgnsdghcgegcqsqcsywrcgkdfggrlctedmccsqygwcgltddhcedgcqs
    qcdlpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulkB (B:)
    apvcgvrasgrvcpdgyccsqwgycgtteeycgkgcqsqcdynrcgkefggkechdelcc
    sqygwcgnsdghcgegcqsqcsywrcgkdfggrlctedmccsqygwcgltddhcedgcqs
    qcdlpt