PDB entry 1ulj

View 1ulj on RCSB PDB site
Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate
Class: oxidoreductase
Keywords: alpha3 beta3 hetero hexamer, OXIDOREDUCTASE
Deposited on 2003-09-12, released 2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.186
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biphenyl dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ulja1, d1ulja2
  • Chain 'B':
    Compound: biphenyl dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uljb_
  • Chain 'C':
    Compound: biphenyl dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uljc1, d1uljc2
  • Chain 'D':
    Compound: biphenyl dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uljd_
  • Chain 'E':
    Compound: biphenyl dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ulje1, d1ulje2
  • Chain 'F':
    Compound: biphenyl dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uljf_
  • Heterogens: FE2, FES, BNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uljA (A:)
    mtdvqcepalagrkpkwadadiaelvdertgrldpriytdealyeqelerifgrswllmg
    hetqipkagdfmtnymgedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsy
    hgwaydtggnlvsvpfeeqafpglrkedwgplqarvetykglifanwdadapdldtylge
    akfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpd
    gvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
    gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
    rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
    yvyseeaarglytqwvrmmtspdwaaldatrpavsestht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uljA (A:)
    wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
    gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
    eeqafpglrkedwgplqarvetykglifanwdadapdldtylgeakfymdhmldrteagt
    eaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpptegiqyratwgghgsg
    fyigdpnlllaimgpkvteywtqgpaaekaserlgstergqqlmaqhmtifptcsflpgi
    ntirawhprgpneievwaftvvdadapeemkeeyrqqtlrtfsaggvfeqddgenwveiq
    qvlrghkarsrpfnaemglgqtdsdnpdypgtisyvyseeaarglytqwvrmmtspdwaa
    ldatr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uljB (B:)
    midaespttafrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpir
    ttrimretaqeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivd
    gekpgeyhvssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstils
    nnlsfff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uljB (B:)
    frtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimretaq
    eysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhvs
    svfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uljC (C:)
    mtdvqcepalagrkpkwadadiaelvdertgrldpriytdealyeqelerifgrswllmg
    hetqipkagdfmtnymgedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsy
    hgwaydtggnlvsvpfeeqafpglrkedwgplqarvetykglifanwdadapdldtylge
    akfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpd
    gvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
    gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
    rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
    yvyseeaarglytqwvrmmtspdwaaldatrpavsestht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uljC (C:)
    wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
    gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
    eeqafpglrkedwgplqarvetykglifanwdadapdldtylgeakfymdhmldrteagt
    eaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilagltegiqyratwgghgsgfy
    igdpnlllaimgpkvteywtqgpaaekaserlgstergqqlmaqhmtifptcsflpgint
    irawhprgpneievwaftvvdadapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqv
    lrghkarsrpfnaemglgqtdsdnpdypgtisyvyseeaarglytqwvrmmtspdwaald
    atrpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uljD (D:)
    midaespttafrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpir
    ttrimretaqeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivd
    gekpgeyhvssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstils
    nnlsfff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uljD (D:)
    afrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimreta
    qeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhv
    ssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uljE (E:)
    mtdvqcepalagrkpkwadadiaelvdertgrldpriytdealyeqelerifgrswllmg
    hetqipkagdfmtnymgedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsy
    hgwaydtggnlvsvpfeeqafpglrkedwgplqarvetykglifanwdadapdldtylge
    akfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpd
    gvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
    gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
    rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
    yvyseeaarglytqwvrmmtspdwaaldatrpavsestht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uljE (E:)
    wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
    gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
    eeqafpglrkedwgplqarvetykglifanwdadapdldtylgeakfymdhmldrteagt
    eaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglptegiqyratwgghgsgf
    yigdpnlllaimgpkvteywtqgpaaekaserlgstergqqlmaqhmtifptcsflpgin
    tirawhprgpneievwaftvvdadapeemkeeyrqqtlrtfsaggvfeqddgenwveiqq
    vlrghkarsrpfnaemglgqtdsdnpdypgtisyvyseeaarglytqwvrmmtspdwaal
    datrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uljF (F:)
    midaespttafrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpir
    ttrimretaqeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivd
    gekpgeyhvssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstils
    nnlsfff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uljF (F:)
    frtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimretaq
    eysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhvs
    svfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff