PDB entry 1uli

View 1uli on RCSB PDB site
Description: Biphenyl dioxygenase (BphA1A2) derived from Rhodococcus sp. strain RHA1
Class: oxidoreductase
Keywords: Alpha3 Beta3 hetero hexamer, OXIDOREDUCTASE
Deposited on 2003-09-12, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biphenyl dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulia1, d1ulia2
  • Chain 'B':
    Compound: biphenyl dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulib_
  • Chain 'C':
    Compound: biphenyl dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulic1, d1ulic2
  • Chain 'D':
    Compound: biphenyl dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulid_
  • Chain 'E':
    Compound: biphenyl dioxygenase large subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulie1, d1ulie2
  • Chain 'F':
    Compound: biphenyl dioxygenase small subunit
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulif_
  • Heterogens: FE2, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uliA (A:)
    mtdvqcepalagrkpkwadadiaelvdertgrldpriytdealyeqelerifgrswllmg
    hetqipkagdfmtnymgedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsy
    hgwaydtggnlvsvpfeeqafpglrkedwgplqarvetykglifanwdadapdldtylge
    akfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpd
    gvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
    gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
    rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
    yvyseeaarglytqwvrmmtspdwaaldatrpavsestht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uliA (A:)
    wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
    gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
    eeqafpglrkedwgplqarvetykglifanwdadapdldtylgeakfymdhmldrteagt
    eaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglptegiqyratwgghgsgf
    yigdpnlllaimgpkvteywtqgpaaekaserlgstergqqlmaqhmtifptcsflpgin
    tirawhprgpneievwaftvvdadapeemkeeyrqqtlrtfsaggvfeqddgenwveiqq
    vlrghkarsrpfnaemglgqtdsdnpdypgtisyvyseeaarglytqwvrmmtspdwaal
    datr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uliB (B:)
    midaespttafrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpir
    ttrimretaqeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivd
    gekpgeyhvssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstils
    nnlsfff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uliB (B:)
    frtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimretaq
    eysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhvs
    svfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uliC (C:)
    mtdvqcepalagrkpkwadadiaelvdertgrldpriytdealyeqelerifgrswllmg
    hetqipkagdfmtnymgedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsy
    hgwaydtggnlvsvpfeeqafpglrkedwgplqarvetykglifanwdadapdldtylge
    akfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpd
    gvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
    gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
    rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
    yvyseeaarglytqwvrmmtspdwaaldatrpavsestht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uliC (C:)
    wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
    gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
    eeqafpglrkedwgplqarvetykglifanwdadapdldtylgeakfymdhmldrteagt
    eaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilagltegiqyratwgghgsgfy
    igdpnlllaimgpkvteywtqgpaaekaserlgstergqqlmaqhmtifptcsflpgint
    irawhprgpneievwaftvvdadapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqv
    lrghkarsrpfnaemglgqtdsdnpdypgtisyvyseeaarglytqwvrmmtspdwaald
    atrpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uliD (D:)
    midaespttafrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpir
    ttrimretaqeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivd
    gekpgeyhvssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstils
    nnlsfff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uliD (D:)
    afrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimreta
    qeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhv
    ssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uliE (E:)
    mtdvqcepalagrkpkwadadiaelvdertgrldpriytdealyeqelerifgrswllmg
    hetqipkagdfmtnymgedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsy
    hgwaydtggnlvsvpfeeqafpglrkedwgplqarvetykglifanwdadapdldtylge
    akfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglpd
    gvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserl
    gstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeey
    rqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtis
    yvyseeaarglytqwvrmmtspdwaaldatrpavsestht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uliE (E:)
    wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
    gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
    eeqafpglrkedwgplqarvetykglifanwdadapdldtylgeakfymdhmldrteagt
    eaipgiqkwvipcnwkfaaeqfcsdmyhagttshlsgilaglptegiqyratwgghgsgf
    yigdpnlllaimgpkvteywtqgpaaekaserlgstergqqlmaqhmtifptcsflpgin
    tirawhprgpneievwaftvvdadapeemkeeyrqqtlrtfsaggvfeqddgenwveiqq
    vlrghkarsrpfnaemglgqtdsdnpdypgtisyvyseeaarglytqwvrmmtspdwaal
    datrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uliF (F:)
    midaespttafrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpir
    ttrimretaqeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivd
    gekpgeyhvssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstils
    nnlsfff
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uliF (F:)
    frtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimretaq
    eysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhvs
    svfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff