PDB entry 1ulh

View 1ulh on RCSB PDB site
Description: A short peptide insertion crucial for angiostatic activity of human tryptophanyl-tRNA synthetase
Class: Ligase
Keywords: aminoacylation, angiostatic cytokine, apoptosis, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Ligase
Deposited on 2003-09-12, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.241
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: trpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulha_
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: trpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ulhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ulhA (A:)
    edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
    dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
    lwkdltldqaysyavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
    qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
    dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
    dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
    iaehqarrkevtdeivkefmtprklsfdfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulhA (A:)
    ydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpfyly
    tgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyavena
    kdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkis
    fpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallhstf
    fpalqgapnssifltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffl
    edddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprkls
    fdfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ulhB (B:)
    edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
    dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
    lwkdltldqaysyavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
    qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
    dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
    dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
    iaehqarrkevtdeivkefmtprklsfdfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ulhB (B:)
    edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
    dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
    lwkdltldqaysyavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
    qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
    dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
    ggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrk
    evtdeivkefmtprklsfd