PDB entry 1ulg

View 1ulg on RCSB PDB site
Description: CGL2 in complex with Thomsen-Friedenreich antigen
Class: sugar binding protein
Keywords: galectin, lectin, beta-galactoside binding lectin, sugar binding, SUGAR BINDING PROTEIN
Deposited on 2003-09-12, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-2
    Species: Coprinopsis cinerea [TaxId:5346]
    Gene: cgl2
    Database cross-references and differences (RAF-indexed):
    • GB AAF34732 (0-149)
    Domains in SCOPe 2.07: d1ulga_
  • Chain 'B':
    Compound: galectin-2
    Species: Coprinopsis cinerea [TaxId:5346]
    Gene: cgl2
    Database cross-references and differences (RAF-indexed):
    • GB AAF34732 (0-149)
    Domains in SCOPe 2.07: d1ulgb_
  • Chain 'C':
    Compound: galectin-2
    Species: Coprinopsis cinerea [TaxId:5346]
    Gene: cgl2
    Database cross-references and differences (RAF-indexed):
    • GB AAF34732 (0-149)
    Domains in SCOPe 2.07: d1ulgc_
  • Chain 'D':
    Compound: galectin-2
    Species: Coprinopsis cinerea [TaxId:5346]
    Gene: cgl2
    Database cross-references and differences (RAF-indexed):
    • GB AAF34732 (0-149)
    Domains in SCOPe 2.07: d1ulgd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulgA (A:)
    mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
    ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
    aaiaynaenslfsspvtvdvhgllpplppa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulgB (B:)
    mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
    ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
    aaiaynaenslfsspvtvdvhgllpplppa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulgC (C:)
    mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
    ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
    aaiaynaenslfsspvtvdvhgllpplppa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulgD (D:)
    mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
    ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
    aaiaynaenslfsspvtvdvhgllpplppa