PDB entry 1ulc

View 1ulc on RCSB PDB site
Description: CGL2 in complex with lactose
Class: sugar binding protein
Keywords: galectin, lectin, beta-galactoside binding lectin, sugar binding, SUGAR BINDING PROTEIN
Deposited on 2003-09-12, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-2
    Species: Coprinopsis cinerea [TaxId:5346]
    Gene: cgl2
    Database cross-references and differences (RAF-indexed):
    • GB AAF34732 (0-149)
    Domains in SCOPe 2.07: d1ulca_
  • Chain 'B':
    Compound: galectin-2
    Species: Coprinopsis cinerea [TaxId:5346]
    Gene: cgl2
    Database cross-references and differences (RAF-indexed):
    • GB AAF34732 (0-149)
    Domains in SCOPe 2.07: d1ulcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ulcA (A:)
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ulcB (B:)
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa