PDB entry 1ulb

View 1ulb on RCSB PDB site
Description: application of crystallographic and modeling methods in the design of purine nucleoside phosphorylase inhibitors
Deposited on 1991-11-05, released 1993-01-15
The last revision prior to the SCOP 1.67 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.75 Å
R-factor: 0.204
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1ulb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulb_ (-)
    mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
    vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
    npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
    mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas