PDB entry 1ula

View 1ula on RCSB PDB site
Description: application of crystallographic and modeling methods in the design of purine nucleoside phosphorylase inhibitors
Class: pentosyltransferase
Keywords: pentosyltransferase
Deposited on 1991-11-05, released 1993-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.202
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ulaa_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ulaA (A:)
    mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
    vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
    npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
    mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas