PDB entry 1ul7

View 1ul7 on RCSB PDB site
Description: solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
Deposited on 2003-09-10, released 2004-03-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-10, with a file datestamp of 2004-03-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ul7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ul7A (A:)
  gssgssgrftwsmkttssmdpsdmmreirkvlganncdyeqrerfllfcvhgdghaenlv
  qwemevcklprlslngvrfkrisgtsiafkniaskianelkl