PDB entry 1ul7

View 1ul7 on RCSB PDB site
Description: Solution structure of kinase associated domain 1 of mouse MAP/microtubule affinity-regulating kinase 3
Class: transferase
Keywords: KA1 domain, ELKL motif, MARK3, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-09-10, released 2004-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MAP/microtubule affinity-regulating kinase 3
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1600015G02, Mark3, Emk2, Mpk10
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03141 (7-101)
    • cloning artifact (0-6)
    • conflict (32)
  Domains in SCOPe 2.08: d1ul7a1, d1ul7a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ul7A (A:)
  gssgssgrftwsmkttssmdpsdmmreirkvlganncdyeqrerfllfcvhgdghaenlv
  qwemevcklprlslngvrfkrisgtsiafkniaskianelkl