PDB entry 1ul5

View 1ul5 on RCSB PDB site
Description: solution structure of the dna-binding domain of squamosa promoter binding protein-like 7
Deposited on 2003-09-09, released 2004-03-09
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ul5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ul5A (A:)
gsvarcqvpdceadiselkgyhkrhrvclrcatasfvvldgenkrycqqcgkfhllpdfd
egkrscrrklerhnnrrkrkpvdkggva

    Sequence, based on observed residues (ATOM records): (download) 
    >1ul5A (A:)
varcqvpdceadiselkgyhkrhrvclrcatasfvvldgenkrycqqcgkfhllpdfdeg
krscrrklerhnnrrkrkpvdkggva