PDB entry 1ul5

View 1ul5 on RCSB PDB site
Description: Solution structure of the DNA-binding domain of squamosa promoter binding protein-like 7
Class: DNA binding protein
Keywords: Transcription factor, SBP, Flower development, DNA binding protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-09-09, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: squamosa promoter binding protein-like 7
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SPL7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ul5a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ul5A (A:)
    gsvarcqvpdceadiselkgyhkrhrvclrcatasfvvldgenkrycqqcgkfhllpdfd
    egkrscrrklerhnnrrkrkpvdkggva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul5A (A:)
    varcqvpdceadiselkgyhkrhrvclrcatasfvvldgenkrycqqcgkfhllpdfdeg
    krscrrklerhnnrrkrkpvdkggva