PDB entry 1ul4

View 1ul4 on RCSB PDB site
Description: Solution structure of the DNA-binding domain of squamosa promoter binding protein-like 4
Deposited on 2003-09-09, released 2004-03-09
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ul4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ul4A (A:)
    gssgssglrlcqvdrctadmkeaklyhrrhkvcevhakassvflsglnqrfcqqcsrfhd
    lqefdeakrscrrrlaghnerrrkssgesgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul4A (A:)
    lrlcqvdrctadmkeaklyhrrhkvcevhakassvflsglnqrfcqqcsrfhdlqefdea
    krscrrrlaghnerrrkssge