PDB entry 1ul3

View 1ul3 on RCSB PDB site
Description: Crystal Structure of PII from Synechocystis sp. PCC 6803
Class: signaling protein
Keywords: nitrogen regulation, cyanobacteria, SIGNALING PROTEIN
Deposited on 2003-09-09, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: Synechocystis sp. [TaxId:1143]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul3a_
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: Synechocystis sp. [TaxId:1143]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul3b_
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: Synechocystis sp. [TaxId:1143]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul3c_
  • Chain 'D':
    Compound: nitrogen regulatory protein p-II
    Species: Synechocystis sp. [TaxId:1143]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ul3d_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ul3A (A:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul3A (A:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfeflqklkieivvdegqvdmvvdkl
    vsaartgeigdgkifispvdsvvrirtgekdteai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ul3B (B:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul3B (B:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfflqklkieivvdegqvdmvvdklv
    saartgeigdgkifispvdsvvrirtgekdteai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ul3C (C:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul3C (C:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfflqklkieivvdegqvdmvvdklv
    saartgeigdgkifispvdsvvrirtgekdteai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ul3D (D:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ul3D (D:)
    mkkveaiirpfkldevkialvnagivgmtvsevrgfgreflqklkieivvdegqvdmvvd
    klvsaartgeigdgkifispvdsvvrirtgekdte