PDB entry 1ukx

View 1ukx on RCSB PDB site
Description: Solution structure of the RWD domain of mouse GCN2
Class: transferase
Keywords: eIF2alpha kinase, UBC-like fold, triple beta-turns, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-09-03, released 2004-08-03
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GCN2 eIF2alpha kinase
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 2900069K12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZ05 (8-130)
      • cloning artifact (0-7)
      • cloning artifact (131-136)
    Domains in SCOP 1.73: d1ukxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ukxA (A:)
    gssgssgmesysqrqdhelqaleaiygsdfqdlrpdargrvreppeinlvlypqglagee
    vyvqvelrvkcpptypdvvpeidlknakglsnesvnllkshleelakkqcgevmifelah
    hvqsflsehnksgpssg