PDB entry 1ukw

View 1ukw on RCSB PDB site
Description: Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-09-02, released 2004-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus
    Gene:
    Domains in SCOP 1.73: d1ukwa1, d1ukwa2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus
    Gene:
    Domains in SCOP 1.73: d1ukwb1, d1ukwb2
  • Heterogens: CO, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ukwA (A:)
    idfslteeqrqlqalarrfakevilpvaqeydekeevpwpvieklhevgllnaiipeeyg
    gmglkmldevivgeelayacmgiytipmasdlgitpvllagteeqkerflrpltekpala
    afalsepgngsdaaalktrairqgdhyvlngtkmwisnggeaewvvvfatvnpelrhkgv
    valvvergtpgfkaikihgkmgqrasgtyelvfedvkvpvenrlgeegegfkiamqtlnk
    tripvaagsvgvarraldearkyakereafgepianfqaiqfklvdmligietarmytyy
    aawladqglphahasaiakayaseiafeaanqaiqihggygyvrefpvekllrdvklnqi
    yegtneiqrliiarhilaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ukwB (B:)
    idfslteeqrqlqalarrfakevilpvaqeydekeevpwpvieklhevgllnaiipeeyg
    gmglkmldevivgeelayacmgiytipmasdlgitpvllagteeqkerflrpltekpala
    afalsepgngsdaaalktrairqgdhyvlngtkmwisnggeaewvvvfatvnpelrhkgv
    valvvergtpgfkaikihgkmgqrasgtyelvfedvkvpvenrlgeegegfkiamqtlnk
    tripvaagsvgvarraldearkyakereafgepianfqaiqfklvdmligietarmytyy
    aawladqglphahasaiakayaseiafeaanqaiqihggygyvrefpvekllrdvklnqi
    yegtneiqrliiarhilaa