PDB entry 1ukv

View 1ukv on RCSB PDB site
Description: Structure of RabGDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
Class: protein transport
Keywords: GTPase, Hydrolase, GDP dissociation inhibitor, vesicular transport, PROTEIN TRANSPORT
Deposited on 2003-09-01, released 2004-09-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Secretory pathway GDP dissociation inhibitor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ukvg1, d1ukvg2, d1ukvg3
  • Chain 'Y':
    Compound: GTP-binding protein YPT1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ukvy_
  • Heterogens: MG, GER, GDP, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ukvG (G:)
    ghmdqetidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlye
    kfkqnpiskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyv
    fkqgkiykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmde
    vyykfglgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyg
    lgelpqgfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfp
    ekckstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskg
    hylaiistiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydas
    shfesmtddvkdiyfrvtghplvlkqrqeqekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukvG (G:)
    tidtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnp
    iskeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgki
    ykvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfg
    lgnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpq
    gfarlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekckst
    gqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghylaii
    stiietdkphielepafkllgpieekfmgiaelfepredgskdniylsrsydasshfesm
    tddvkdiyfrvtghplvlkqrq
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1ukvY (Y:)
    mnseydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklq
    iwdtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvg
    nkcdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlne
    ttqkkedkgnvnlkgqsltntgggcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukvY (Y:)
    seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
    dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
    cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
    qkkedkgnvnlkgqslc