PDB entry 1uku

View 1uku on RCSB PDB site
Description: Crystal Structure of Pyrococcus horikoshii CutA1 Complexed with Cu2+
Deposited on 2003-09-01, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.165
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1ukua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ukuA (A:)
  miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
  lweelkerikelhpydvpaiiridvddvnedylkwlieetkk