PDB entry 1uku

View 1uku on RCSB PDB site
Description: Crystal Structure of Pyrococcus horikoshii CutA1 Complexed with Cu2+
Class: metal binding protein
Keywords: CUTA, COPPER TOLERANCE, structural genomics, METAL BINDING PROTEIN
Deposited on 2003-09-01, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.165
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukua_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ukuA (A:)
    miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
    lweelkerikelhpydvpaiiridvddvnedylkwlieetkk