PDB entry 1ukr

View 1ukr on RCSB PDB site
Description: structure of endo-1,4-beta-xylanase c
Class: hydrolase
Keywords: xylan degradation, hydrolase, glycosidase, signal
Deposited on 1996-08-23, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-b-xylanase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukra_
  • Chain 'B':
    Compound: endo-1,4-b-xylanase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukrb_
  • Chain 'C':
    Compound: endo-1,4-b-xylanase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukrc_
  • Chain 'D':
    Compound: endo-1,4-b-xylanase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ukrA (A:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukrA (A:)
    ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
    sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
    gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ukrB (B:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukrB (B:)
    ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
    sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
    gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ukrC (C:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukrC (C:)
    ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
    sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
    gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ukrD (D:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukrD (D:)
    ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
    sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
    gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
    s