PDB entry 1ukm

View 1ukm on RCSB PDB site
Description: crystal structure of ems16, an antagonist of collagen receptor integrin alpha2beta1 (gpia/iia)
Deposited on 2003-08-27, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ukma_
  • Chain 'B':
    Domains in SCOP 1.67: d1ukmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ukmA (A:)
    dfdcpsdwtaydqhcylaigepqnwyeaerfcteqakdghlvsiqsreegnfvaqlvsgf
    mhrseiyvwiglrdrreeqqcnpewndgskiiyvnwkegeskmcqgltkwtnfhdwnnin
    cedlypfvckfsav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukmA (A:)
    dcpsdwtaydqhcylaigepqnwyeaerfcteqakdghlvsiqsreegnfvaqlvsgfmh
    rseiyvwiglrdrreeqqcnpewndgskiiyvnwkegeskmcqgltkwtnfhdwnnince
    dlypfvckfsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ukmB (B:)
    cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
    tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
    kfltdpav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukmB (B:)
    cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
    tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
    kflt