PDB entry 1ukm

View 1ukm on RCSB PDB site
Description: Crystal structure of EMS16, an Antagonist of collagen receptor integrin alpha2beta1 (GPIa/IIa)
Class: toxin
Keywords: Domain swapping, C-type lectin, TOXIN
Deposited on 2003-08-27, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EMS16 A chain
    Species: Echis multisquamatus [TaxId:93050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ukma_
  • Chain 'B':
    Compound: EMS16 B chain
    Species: Echis multisquamatus [TaxId:93050]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7T2Q0 (0-End)
      • see remark 999 (42)
    Domains in SCOPe 2.08: d1ukmb_
  • Heterogens: CL, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ukmA (A:)
    dfdcpsdwtaydqhcylaigepqnwyeaerfcteqakdghlvsiqsreegnfvaqlvsgf
    mhrseiyvwiglrdrreeqqcnpewndgskiiyvnwkegeskmcqgltkwtnfhdwnnin
    cedlypfvckfsav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukmA (A:)
    dcpsdwtaydqhcylaigepqnwyeaerfcteqakdghlvsiqsreegnfvaqlvsgfmh
    rseiyvwiglrdrreeqqcnpewndgskiiyvnwkegeskmcqgltkwtnfhdwnnince
    dlypfvckfsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ukmB (B:)
    cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
    tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
    kfltdpav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukmB (B:)
    cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
    tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
    kflt