PDB entry 1ukl

View 1ukl on RCSB PDB site
Description: Crystal structure of Importin-beta and SREBP-2 complex
Class: protein transport/DNA binding protein
Keywords: Transcription factor, Nuclear transport factor, HEAT repeat, Helix-Loop-Helix Leucine zipper, PROTEIN TRANSPORT/DNA BINDING PROTEIN COMPLEX
Deposited on 2003-08-26, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.239
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin beta-1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70168 (0-875)
      • see remark 999 (387)
    Domains in SCOPe 2.07: d1ukla_
  • Chain 'B':
    Compound: importin beta-1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70168 (0-875)
      • see remark 999 (387)
    Domains in SCOPe 2.07: d1uklb_
  • Chain 'C':
    Compound: Sterol regulatory element binding protein-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12772 (0-60)
      • modified residue (15)
      • modified residue (21)
      • modified residue (49)
    Domains in SCOPe 2.07: d1uklc_
  • Chain 'D':
    Compound: Sterol regulatory element binding protein-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12772 (0-60)
      • modified residue (15)
      • modified residue (21)
      • modified residue (49)
    Domains in SCOPe 2.07: d1ukld_
  • Chain 'E':
    Compound: Sterol regulatory element binding protein-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12772 (0-60)
      • modified residue (15)
      • modified residue (21)
      • modified residue (49)
    Domains in SCOPe 2.07: d1ukle_
  • Chain 'F':
    Compound: Sterol regulatory element binding protein-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12772 (0-60)
      • modified residue (15)
      • modified residue (21)
      • modified residue (49)
    Domains in SCOPe 2.07: d1uklf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uklA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllstcce
    ddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptlielmkdp
    svvvrdttawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsnilpfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdfdmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uklB (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllstcce
    ddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptlielmkdp
    svvvrdttawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsnilpfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdfdmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uklC (C:)
    rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
    l
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uklD (D:)
    rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
    l
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uklE (E:)
    rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
    l
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uklF (F:)
    rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
    l