PDB entry 1ukk

View 1ukk on RCSB PDB site
Description: Structure of Osmotically Inducible Protein C from Thermus thermophilus
Class: oxidoreductase
Keywords: peroxidase, cysteinesulfinic acid, osmotic, inducible, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2003-08-24, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Osmotically inducible protein C
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukka_
  • Chain 'B':
    Compound: Osmotically inducible protein C
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ukkb_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ukkA (A:)
    mpvrkakavwegglrqgkgvmelqsqafqgpysypsrfeegegtnpeeliaaahagcfsm
    alaasleregfppkrvstearvhlevvdgkptltriellteaevpgissekfleiaeaak
    egcpvsralagvkevvltarlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukkA (A:)
    pvrkakavwegglrqgkgvmelqsqafqgpysypsrfeegegtnpeeliaaahagcfsma
    laasleregfppkrvstearvhlevvdgkptltriellteaevpgissekfleiaeaake
    gcpvsralagvkevvltarlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ukkB (B:)
    mpvrkakavwegglrqgkgvmelqsqafqgpysypsrfeegegtnpeeliaaahagcfsm
    alaasleregfppkrvstearvhlevvdgkptltriellteaevpgissekfleiaeaak
    egcpvsralagvkevvltarlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukkB (B:)
    pvrkakavwegglrqgkgvmelqsqafqgpysypsrfeegegtnpeeliaaahagcfsma
    laasleregfppkrvstearvhlevvdgkptltriellteaevpgissekfleiaeaake
    gcpvsralagvkevvltarlv