PDB entry 1ukh

View 1ukh on RCSB PDB site
Description: Structural basis for the selective inhibition of JNK1 by the scaffolding protein JIP1 and SP600125
Class: transferase
Keywords: TRANSFERASE, Phosphorylation
Deposited on 2003-08-23, released 2004-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitogen-activated protein kinase 8 isoform 4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ukha_
  • Chain 'B':
    Compound: 11-mer peptide from C-jun-amino-terminal kinase interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ukhA (A:)
    msrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrp
    fqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemikggvlfpgtdhidqwnkvieq
    lgtpcpefmkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllsk
    mlvidaskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykev
    mdlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ukhA (A:)
    nfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqthak
    rayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldherm
    syllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglyyrapevilgmgyken
    vdiwsvgcimgemikggvlfpgtdhidqwnkvieqlgtpcpefmkklqptvrtyvenrpk
    yagysfeklfpdvlfpnklkasqardllskmlvidaskrisvdealqhpyinvwydpsea
    eapppkieewkeliykevmdl
    

  • Chain 'B':
    No sequence available.