PDB entry 1ukf

View 1ukf on RCSB PDB site
Description: Crystal Structure of Pseudomonas Avirulence Protein AvrPphB
Class: hydrolase
Keywords: AvrPphB, AvrPph3, Avirulence, Hypersensitive Response, HYDROLASE
Deposited on 2003-08-21, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.204
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avirulence protein AVRPPH3
    Species: Pseudomonas syringae pv. phaseolicola [TaxId:319]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52430 (0-186)
      • expression tag (187)
    Domains in SCOPe 2.07: d1ukfa1, d1ukfa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ukfA (A:)
    slsdfsvasrdvnhnnicaglstewlvmssdgdaesrmdhldyngegqsrgserhqvynd
    alraalsnddeapfftastaviedagfslrrepktvhasggsaqlgqtvahdvaqsgrkh
    llslrfanvqghaiacscegsqfklfdpnlgefqssrsaapqlikglidhynslnydvac
    vnefrvsv