PDB entry 1uk8

View 1uk8 on RCSB PDB site
Description: Crystal structure of a meta-cleavage product hydrolase (CumD) complexed with n-valerate
Class: hydrolase
Keywords: aromatic compounds, cumene, isopropylbenzene, meta-cleavage compound hydrolase, polychlorinated biphenyl degradation, pseudomonas fluorescens ip01, alpha/beta-hydrolase, substrate specificity, cumene degradation, pcb, beta-ketolase
Deposited on 2003-08-19, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: CUMD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96965
      • engineered (102)
    Domains in SCOPe 2.07: d1uk8a_
  • Heterogens: LEA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uk8A (A:)
    manleigksilaagvltnyhdvgegqpvilihgsgpgvsayanwrltipalskfyrviap
    dmvgfgftdrpenynyskdswvdhiigimdaleiekahivgnafggglaiatalryserv
    drmvlmgaagtrfdvteglnavwgytpsienmrnlldifaydrslvtdelarlryeasiq
    pgfqesfssmfpeprqrwidalassdediktlpnetliihgredqvvplssslrlgelid
    raqlhvfgrcghwtqieqtdrfnrlvveffneantpklvgrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uk8A (A:)
    nleigksilaagvltnyhdvgegqpvilihgsgpgvsayanwrltipalskfyrviapdm
    vgfgftdrpenynyskdswvdhiigimdaleiekahivgnafggglaiatalryservdr
    mvlmgaagtrfdvteglnavwgytpsienmrnlldifaydrslvtdelarlryeasiqpg
    fqesfssmfpeprqrwidalassdediktlpnetliihgredqvvplssslrlgelidra
    qlhvfgrcghwtqieqtdrfnrlvveffnea