PDB entry 1uk5

View 1uk5 on RCSB PDB site
Description: Solution structure of the Murine BAG domain of Bcl2-associated athanogene 3
Class: chaperone
Keywords: Triple Helix Bandle, CAIR-1, Bis, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, CHAPERONE
Deposited on 2003-08-19, released 2004-02-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BAG-family molecular chaperone regulator-3
    Species: Mus musculus [TaxId:10090]
    Gene: FANTOM 2 cDNA 4931440G06
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLV1 (7-104)
      • expression tag (0-6)
      • expression tag (105-110)
    Domains in SCOPe 2.05: d1uk5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uk5A (A:)
    gssgssgapaepaapksgeaetppkhpgvlkveailekvqgleqavdsfegkktdkkylm
    ieeyltkellaldsvdpegradvrqarrdgvrkvqtilekleqkasgpssg