PDB entry 1uk5

View 1uk5 on RCSB PDB site
Description: solution structure of the murine bag domain of bcl2-associated athanogene 3
Deposited on 2003-08-19, released 2004-02-19
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-19, with a file datestamp of 2004-02-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1uk5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uk5A (A:)
  gssgssgapaepaapksgeaetppkhpgvlkveailekvqgleqavdsfegkktdkkylm
  ieeyltkellaldsvdpegradvrqarrdgvrkvqtilekleqkasgpssg