PDB entry 1ujz

View 1ujz on RCSB PDB site
Description: Crystal structure of the E7_C/Im7_C complex; a computationally designed interface between the colicin E7 DNase and the Im7 Immunity protein
Class: immune system
Keywords: computational design, redesigned protein-protein interface, specificity, molecular recognition, protein complex, IMMUNE SYSTEM
Deposited on 2003-08-13, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Designed Colicin E7 immunity protein
    Species: Escherichia coli [TaxId:562]
    Gene: CEIE7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03708 (0-86)
      • engineered (34)
    Domains in SCOPe 2.08: d1ujza_
  • Chain 'B':
    Compound: Designed Colicin E7 DNase
    Species: Escherichia coli [TaxId:562]
    Gene: CEIE7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-127)
      • engineered (82)
      • engineered (93)
      • engineered (123)
    Domains in SCOPe 2.08: d1ujzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ujzA (A:)
melknsisdyteaefvqllkeiekenvaatddvlyvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1ujzB (B:)
krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevsk
dpelskqfsrnnndrmkvgkapqtrtqdvsgkrrsfelhhekpisqnggvydmdnisvvt
pkraidih

    Sequence, based on observed residues (ATOM records): (download) 
    >1ujzB (B:)
rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
pelskqfsrnnndrmkvgkapqtrtqdvsgkrrsfelhhekpisqnggvydmdnisvvtp
kraidih