PDB entry 1ujx

View 1ujx on RCSB PDB site
Description: The forkhead associated (FHA) domain like structure from mouse polynucleotide kinase 3'-phosphatase
Class: hydrolase,transferase
Keywords: DNA REPAIR, FHA domain, polynucleotide kinase 3'-phosphatase, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-08-12, released 2004-02-12
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-12, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: polynucleotide kinase 3'-phosphatase
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 1810009G08
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JLV6 (7-112)
    • cloning artifact (0-6)
    • cloning artifact (113-118)
  Domains in SCOP 1.73: d1ujxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujxA (A:)
  gssgssgmsqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqvel
  iadpesrtvavkqlgvnpstvgvqelkpglsgslslgdvlylvnglypltlrwsgpssg