PDB entry 1ujx

View 1ujx on RCSB PDB site
Description: the forkhead associated (fha) domain like structure from mouse polynucleotide kinase 3'-phosphatase
Deposited on 2003-08-12, released 2004-02-12
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-12, with a file datestamp of 2004-02-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1ujxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujxA (A:)
  gssgssgmsqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqvel
  iadpesrtvavkqlgvnpstvgvqelkpglsgslslgdvlylvnglypltlrwsgpssg