PDB entry 1ujx

View 1ujx on RCSB PDB site
Description: The forkhead associated (FHA) domain like structure from mouse polynucleotide kinase 3'-phosphatase
Class: hydrolase,transferase
Keywords: DNA REPAIR, FHA domain, polynucleotide kinase 3'-phosphatase, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE,TRANSFERASE
Deposited on 2003-08-12, released 2004-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polynucleotide kinase 3'-phosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1810009G08
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLV6 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.07: d1ujxa1, d1ujxa2, d1ujxa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujxA (A:)
    gssgssgmsqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqvel
    iadpesrtvavkqlgvnpstvgvqelkpglsgslslgdvlylvnglypltlrwsgpssg