PDB entry 1ujv

View 1ujv on RCSB PDB site
Description: Solution structure of the second PDZ domain of human membrane associated guanylate kinase inverted-2 (MAGI-2)
Class: signaling protein
Keywords: atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-11, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: membrane associated guanylate kinase inverted-2 (magi-2)
  Species: HOMO SAPIENS
  Gene: KAZUSA cDNA hg03359
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86UL8 (7-89)
    • cloning artifact (0-6)
    • cloning artifact (90-95)
  Domains in SCOP 1.73: d1ujva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujvA (A:)
  gssgssgqaelmtltivkgaqgfgftiadsptgqrvkqildiqgcpglcegdliveinqq
  nvqnlshtevvdilkdcpigsetsliihrgsgpssg