PDB entry 1ujv

View 1ujv on RCSB PDB site
Description: Solution structure of the second PDZ domain of human membrane associated guanylate kinase inverted-2 (MAGI-2)
Class: signaling protein
Keywords: atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane associated guanylate kinase inverted-2 (magi-2)
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UL8 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.07: d1ujva1, d1ujva2, d1ujva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujvA (A:)
    gssgssgqaelmtltivkgaqgfgftiadsptgqrvkqildiqgcpglcegdliveinqq
    nvqnlshtevvdilkdcpigsetsliihrgsgpssg