PDB entry 1uju

View 1uju on RCSB PDB site
Description: Solution structure of the fourth PDZ domain of human scribble (KIAA0147 protein)
Class: signaling protein
Keywords: PDZ domain, cellular signaling, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: scribble
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA ha01022s1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14160 (7-104)
    • cloning artifact (0-6)
    • cloning artifact (105-110)
  Domains in SCOPe 2.06: d1ujua1, d1ujua2, d1ujua3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujuA (A:)
  gssgssgpglrelciqkapgerlgisirggarghagnprdptdegifiskvsptgaagrd
  grlrvglrllevnqqsllglthgeavqllrsvgdtltvlvcdgfesgpssg