PDB entry 1ujt

View 1ujt on RCSB PDB site
Description: solution structure of the second fibronectin type iii domain of human kiaa1568 protein
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-11, with a file datestamp of 2004-02-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1ujta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujtA (A:)
  gssgssgrqvqkelgdvlvrlhnpvvltpttvqvtwtvdrqpqfiqgyrvmyrqtsglqa
  tsswqnldakvptersavlvnlkkgvtyeikvrpyfnefqgmdsesktvrtteesgpssg