PDB entry 1ujs

View 1ujs on RCSB PDB site
Description: Solution structure of the Villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein)
Class: structural protein
Keywords: VHP domain, actin binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-11, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin-binding LIM protein homologue
    Species: HOMO SAPIENS
    Gene: Kazusa cDNA hk05155
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94929 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOP 1.75: d1ujsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujsA (A:)
    gssgssgnavnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmt
    isefdrlalwkrnelkkqarlfsgpssg