PDB entry 1ujs

View 1ujs on RCSB PDB site
Description: solution structure of the villin headpiece domain of human actin- binding lim protein homologue (kiaa0843 protein)
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-11, with a file datestamp of 2004-02-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ujsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujsA (A:)
    gssgssgnavnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmt
    isefdrlalwkrnelkkqarlfsgpssg