PDB entry 1ujs

View 1ujs on RCSB PDB site
Description: Solution structure of the Villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein)
Class: structural protein
Keywords: VHP domain, actin binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2003-08-11, released 2004-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: actin-binding LIM protein homologue
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA hk05155
  Database cross-references and differences (RAF-indexed):
  • Uniprot O94929 (7-81)
    • cloning artifact (0-6)
    • cloning artifact (82-87)
  Domains in SCOPe 2.08: d1ujsa1, d1ujsa2, d1ujsa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujsA (A:)
  gssgssgnavnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmt
  isefdrlalwkrnelkkqarlfsgpssg