PDB entry 1ujq

View 1ujq on RCSB PDB site
Description: Crystal structure of 2-methylisocitrate lyase (PrpB) from Salmonella enterica serovar typhimurium
Deposited on 2003-08-11, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ujqa_
  • Chain 'B':
    Domains in SCOP 1.67: d1ujqb_
  • Chain 'C':
    Domains in SCOP 1.67: d1ujqc_
  • Chain 'D':
    Domains in SCOP 1.67: d1ujqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujqA (A:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqA (A:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqfeekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujqB (B:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqB (B:)
    spgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgistl
    ddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivske
    emvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitelsm
    yrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvlr
    qegtqknvidimqtrnelyesinyyqfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ujqC (C:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqC (C:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqfeekldal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ujqD (D:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqD (D:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqf