PDB entry 1ujq

View 1ujq on RCSB PDB site
Description: Crystal structure of 2-methylisocitrate lyase (PrpB) from Salmonella enterica serovar typhimurium
Class: Lyase
Keywords: prpb, lyase, methylisocitrate, methylcitrate cycle, tim-2 barrel
Deposited on 2003-08-11, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujqa_
  • Chain 'B':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujqb_
  • Chain 'C':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujqc_
  • Chain 'D':
    Compound: Probable methylisocitrate lyase
    Species: Salmonella enterica [TaxId:90371]
    Gene: prpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujqA (A:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqA (A:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqfeekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujqB (B:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqB (B:)
    spgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgistl
    ddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivske
    emvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitelsm
    yrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvlr
    qegtqknvidimqtrnelyesinyyqfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ujqC (C:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqC (C:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqfeekldal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ujqD (D:)
    masslhspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpd
    lgistlddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqv
    gakrcghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayv
    dagadmlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalypls
    aframnraaekvytvlrqegtqknvidimqtrnelyesinyyqfeekldalyrnkksleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujqD (D:)
    hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
    lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
    eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
    myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
    rqegtqknvidimqtrnelyesinyyqf